Williamslakestampede.com
Williams Lake Stampede is a professional rodeo held in Williams Lake, British Columbia, Canada.
Williamslakestampede.com Domain Statistics
Williamslakestampede.com competitors
The University of British Columbia
The university of british columbia
|
|
www.ubc.ca
Bcit : : British Columbia Institute of Technology
British columbia institute of technology is one of bc's largest post - secondary institutions
|
|
www.bcit.ca
Fsj Now! - Proudly Serving Fort St. John, Bc, Canada And Area
Fort st. John, british columbia, canada and area information
|
|
www.fsjnow.com
University of Northern British Columbia
|
|
www.unbc.ca
go Nanaimo - Gateway to Nanaimo And Vancouver Island
Your gateway to nanaimo, british columbia, with travel articles and photos from across canada
|
|
www.gonanaimo.com
Portail Des Autochtones au Canada | Aboriginal Canada Portal
The aboriginal canada portal offers one stop access to information for and about aboriginal canadians
|
|
www.autochtonesaucanada.com
British Columbia Travel And Adventure Vacations Adventure Travel in Beautiful British Columbia...
Britishcolumbia.com is the largest website network showcasing beautiful british columbia, canada
|
|
www.britishcolumbia.com
Huffpost Canada - Canadian News Stories, Breaking News, Opinion
Get the latest canadian and world news covering politics, business, lifestyle and the viral web
|
|
www.huffingtonpost.ca
Victoria British Columbia - Explore Victoria bc Canada With us
Victoria british columbia is a wonderful vacation destination for families or individuals
|
|
www.victoria-bc-canada-guide.com
Williamslakestampede.com Sites with a similar domain name
We found 17 websites. With this list, you can understand how other people are using the domain, similar to yours.
Willy Berger Williams Lake Real Estate
|
|
williamslake.com
Williams Lake, bc - Official Website | Official Website
City of williams lake,williams lake,bc
|
|
williamslake.ca
Texelc Williams Lake Indian Band
A strong, unified, self sufficient, self governing community, we are the t'exelcemc, the t'exelc people of the northern secwepemc nation. The williams lake indian band
|
|
williamslakeband.ca
,williams Lake Association Waterford, mi
|
|
williamslakewaterford.com
Lac Seul Walleye Fishing at Williams Lake Lodge, Northwest Ontario...
Fishing lac seul and williams lake, northwest ontario, canada for walleye, northen pike, smallmouth bass. Hunting for black bear
|
|
williamslakelodge.net
Williams Lake & District Chamber of Commerce, Williams Lake, Bc...
Williams lake & district chamber of commerce, williams lake, british columbia, canada. The williams lake chamber of commerce provides business and commerce assistance and travel and tourist information from the tourism discovery centre travel info cen
|
|
williamslakechamber.com
Williams Lake Real Estate From Re/max Williams Lake Realty...
From this website you can access up to date williams lake real estate listings, buyer and seller resources, and expert williams lake real estate advice from re/max williams lake realty
|
|
williamslakerealty.com
Williams Lake Real Estate
Williams lake real estate for sale by tanya rankin real estate, williams lake's number one realtor for customer service. Tanya rankin real estate
|
|
williamslakerealestate.com
Williams Lake Conservation Company
The williams lake conservation company is a volunteer, non-profit community organization that promotes the health of williams lake and watershed
|
|
williamslakecc.org
Williams Lake Airport Car Rental - Williams Lake Airport or Williams...
Williams lake airport car rental - williams lake airport or williams lake regional airport (iata: ywl) car rentals
|
|
williamslakeairportcarrental.com
Family Dentist in Williams Lake bc - Dr. Rudy wassenaar
We offer you over 30 years of experience, providing a wide range of family, cosmetic, and implant dentistry services. Financing available
|
|
williamslakesmiles.ca
Williams Lake Secondary School - Williams Lake Secondary School
Williams lake secondary school
|
|
williamslakesecondary.com
Williams Lakeside - Nurturing Awesome Through Homeschooling And a Family...
Nurturing awesome through homeschooling and a family first focused lifestyle
|
|
williamslakeside.com
Williams Lake Skating Club - Home
|
|
williamslakeskatingclub.com
Williams Lake Seniors Village | Retirement Concepts
Williams lake seniors village offers complex care and independent & assisted living services, and is located close to amenities necessary to feel at home
|
|
williamslakeseniorsvillage.com
Williams Lake Scrap Metal Recycling - Home
Williams lake scrap metal recycling
|
|
williamslakescrapmetalrecycling.com
Home | Williams Lake Golf And Tennis Club
Providing a memorable golf experience
|
|
williamslakegolf.ca
Williamslakestampede.com Domain Info
| Domain Name: | williamslakestampede.com |
| Registrar: | GoDaddy.com LLC (R171-LRMS) |
| Domain Age: | 15 years and 3 months |
| See williamslakestampede.com whois information | |
Williamslakestampede.com Contact information :
http://www.williamslakestampede.com/about/
- Williams Lake Stampede. About the Williams Lake Stampede
|
http://www.williamslakestampede.com/contact-us/
- Contact us - Williams Lake Stampede
|
Facebook profile for williamslakestampede.com
- Williams Lake Stampede | Facebook
|
| See williamslakestampede.com contact information in whois record |
Web Safety
williamslakestampede.com is website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.
Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety
|
|
|
|---|---|
|
|
Is Williamslakestampede.com Legal or Not
| URLs Requested to be Removed: | 0 |
|---|---|
| Urls removed: | 0 |
| Percent: | 0% |
| Summary: | Williamslakestampede.com is a legal, because it is not contained in the list of sites - https://transparencyreport.google.com/copyright/domains/ |
Williamslakestampede.com Visitors Localization
| Traffic Estimations | |
|---|---|
| Traffic Rank | 4,311,778th most visited website in the World |
Website categories
| williams lake 239 sites | stampede 615 sites |
| rodeo 4'518 sites | british columbia 14'317 sites |
| canada 123'329 sites | rodeos 261 sites |
Williamslakestampede.com Top Keywords
This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.
| Keyword | Position | Date |
|---|---|---|
| wildhorse saloon stampede tent 2011 | 2 | 2015-12-15 |
| williams lake bc | 10 | 2016-01-01 |
| stampede canada | 12 | 2016-01-14 |
| ponoka stampede campground | 17 | 2016-02-06 |
| william lake bc | 18 | 2016-01-25 |
| williams lake british columbia | 20 | 2016-02-04 |
Williamslakestampede.com Backlinks History
At the last check on 2018-08-17, we found 13 backlinks. The highest value is 13, the lowest value is 13, the average is 13.
Williamslakestampede.com Anchors Cloud
Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"
- <a>image</a>( 75% )
- w.l. stampede( 25% )
Williamslakestampede.com Terms Cloud
List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"
- <a>image</a>( 33% )
- w.l( 33% )
- stampede( 33% )
Williamslakestampede.com Websites hosted on same IP
Thuya Lakes Lodge - Fly Fishing Trout Lodge, Kamloops Bc.
Thuya lakes lodge. Wilderness fly fishing trout lodge & lake shore log cabins near kamloops, bc. Fly fishing for rainbow trout in british columbia, canada
|
|
www.thuyalakes.com
Beckers Lodge, Bowron Lake, bc - Bowron Lake Adventures Resort
Becker’s lodge, bowron lake, provides lakeside cabins and kayak and canoe rentals. Outfitters for the bowron lake canoe circuit
|
|
beckerslodge.ca
Sheridan Lake Resort, Sheridan Lake, bc
Sheridan lake resort, trophy rainbow trout fishing, rv sites, camping, cabins. Trophy rainbow trout fishing sheridan lake, bc, 100 mile house, lone butte
|
|
www.sheridanlakeresort.com
Beckers Lodge, Bowron Lake, bc - Bowron Lake Adventures Resort
Becker’s lodge, bowron lake, provides lakeside cabins and kayak and canoe rentals. Outfitters for the bowron lake canoe circuit
|
|
beckerslodge.com
Williams Lake Curling -
|
|
www.williamslakecurling.com
Woodland Tinnitus And Hearing Clinic
Woodland tinnitus and hearing clinic, williams lake, bc. Hearing tests, assessment and treatment of hearing loss, tinnitus & menieres disease
|
|
woodlandhearing.com
Williamslakestampede.com Website Load Time
Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-31, website load time was 1.57. The highest load time is 2.56, the lowest load time is 1.26, the average load time is 1.54.