Harlandclarke.com

Harland Clarke is a leading provider of integrated payment solutions and integrated marketing services.

Popularity: Safety: Legit: legal Contact info: Contact page dimitri@binex.com
advertising

Harlandclarke.com Domain Statistics

Title:
Harland Clarke | Integrated marketing and payment solutions
Description:
Harland Clarke is a leading provider of integrated payment solutions and integrated marketing services.
SEO score:
45%
Website Worth:
$12,401 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
Primary Traffic:
The country where current domain is most popular relative to the other countries
united states
Webstatsdomain backlinks:
IP-address:
173.203.184.150 [Trace] [Reverse]
Date Registered
1999-10-01 04:00:00
Expires
2016-10-01 04:00:00
Site Age
24 years and 6 months
Email
Owner
Binex Electronic Marketing Inc. ( Inc. )
Pageviews per User:
1.7
Average Time on Site:
01:31
Search Percent:
Estimated percentage of visits to harlandclarke.com that came from a search engine
36.8%
Bounce:
Estimated percentage of visits to harlandclarke.com that consist of a single pageview
61.8%
Daily Pageviews:
n\a
Sites redirect to this site:
www.optinnews.com, create-it.com, checkassure.com, www.not-luck.com, harland-clarke.biz, harland-clarke.com, harland-clarke.info, harland-clarke.net, harland-clarke.org, harland-clarke.us, harlandclarke.biz, harlandclarke.info, harlandclarke.net, harlandclarke.org, harlandclarke.us, www.libertysite.com, createit.com more (17)
Load Time:
0.24 seconds
advertising

Harlandclarke.com competitors

 

Online Marketing Solutions | Harland Clarke Digital

Harland clarke digital offers strategic consulting services and a suite of solutions for marketers to

| | hcdigital.com

 

Bulk Sms - Acura Solution : : Pure & Perfect : Acura Solutions Offer...

Acura solutions provide pure & perfect, reliable & fast services for client in day - today business environment

| | acurasolutions.com

 

Subscribermail Email Marketing by Harland Clarke Digital

Subscribermail is an award - winning email marketing platform, part of a suite of email marketing

| | www.subscribermail.com

 

Liberty is Harland Clarke | Harland Clarke

Writing away with blog.com

| | www.libertysite.com

 

Paysite-cash, Secure E-commerce Payment Solution

Paysite - cash, authorised institution bringing you secure internet card and payment solutions for e

| | paysite-cash.com

 

Holistic Internet - Digital Marketing Agency | - Wsi 1 Click Solutions...

- wsi 1 click solutions holistic digital marketing denver

| | www.wsi1clicksolutions.com

 

Seo Service Staten Island, Seo Company, Seo Service, Seo Marketing...

Seo company, seo service & seo marketing - first page solutions a seo firm and internet marketing

| | www.firstpagesolutions.com

 

Email Marketing And Bulk Email System And From Email Marketing Solutions...

Bulk email marketing system including viral email marketing newsletters and bulkmail in south africa

| | email-marketing.co.za

 

786 Software Technologies - Digital Marketing Solutions - Sms...

Providing digital marketing solutions for sms, email, social media, google apps, data collection database

| | 786software.com

 

Electronic Payment Systems | Integrated Payment Solutions

Paymentvision is a biller - direct, pci - certified, electronic payment systems provider

| | www.paymentvision.com

Harlandclarke.com Sites with a similar domain name

We found 20 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

my Account

| | harlandclarkegiftcard.com

 

Online Marketing Solutions | Harland Clarke Digital

Harland clarke digital offers strategic consulting services and a suite of solutions for marketers to manage digital communications, provide training/education portals and gather customer feedback

| | harlandclarkedigital.com

 

Welcome to The Harlan County Detention Center

Welcome to the harlan county detention center

| | harlandc.com

 

Harland Checks

Harland checks - everything you should know

| | harlandchecks.org

 

Harlandclare.com

Harlandclare.com

| | harlandclare.com

 

Harlandclarc.com

| | harlandclarc.com

 

Welcome to Creeditcard.net - Search Results For "creeditcard...

Harlandclarkgiftcard.com

| | harlandclarkgiftcard.com

 

Harlandclark.net

Harlandclark.net

| | harlandclark.net

 

Harlandclark.com

| | harlandclark.com

 

Harlandclarkecheck.com

| | harlandclarkecheck.com

 

Default.secureserver.net

A quarterly news magazine for clients of harland clarke

| | harlandclarke-dv.com

 

Harlandclarkemilitaryinspiredchecks.info

| | harlandclarkemilitaryinspiredchecks.info

 

Harlandclarkehiringkit.com

| | harlandclarkehiringkit.com

 

Harlandclarkegiftcards.com

Harlandclarkegiftcards.com

| | harlandclarkegiftcards.com

 

Web Page Under Construction

Network solutions - original domain name registration and reservation services with variety of internet-related business offerings. Quick, dependable and reliable

| | harlandclarkegiftcard.net

 

Harland Clarke - Login Page

| | harlandclarkewebsmart.com

 

Harland Clarkeced | i Write, You Read

I write, you read

| | harlandclarkeced.com

 

Harland Capital is a Private And Independent Corporate Finance Advisory House...

In conjunction with its associates and partners the harland capital group offers independent corporate research, corporate finance advice and access to

| | harlandcapital.com

Harlandclarke.com Domain Info

Domain Name: harlandclarke.com
Domain Age: 24 years and 6 months
See harlandclarke.com whois information

Harlandclarke.com subdomains

We found 6 subdomains for this website.

 

American Bank Checks

| | aaa.harlandclarke.com

 

Dsa Portal

| | dsa.harlandclarke.com

 

Harland Clarke Direct Selling Solutions

| | dsahome.harlandclarke.com

 

Employee.harlandclarke.com

| | employee.harlandclarke.com

 

Home Page | Harland Clarke Corp.

| | inside.harlandclarke.com

 

Harland Clarke

| | secureftp.harlandclarke.com

Harlandclarke.com Contact information :

http://harlandclarke.com/about/aboutus - About Us | Harland Clarke
http://harlandclarke.com/main/contact/contactus - Contact Us | Harland Clarke
http://plus.google.com/108895601058059477035 - Harland Clarke – Google+
http://www.linkedin.com/company/harland-clarke/products?trk=tabs_biz_product - Harland Clarke Products & Services | LinkedIn
@harlandclarke - Harland Clarke (HarlandClarke) auf Twitter
See harlandclarke.com contact information in whois record

Web Safety

harlandclarke.com is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Harlandclarke.com Visitors Localization

Traffic Estimations Medium
Traffic Rank 245,735th most visited website in the World
united states 94.2

Website categories

Currently, we found 5 categories on harlandclarke.com
solutions 385'823 sites security solutions 2'582 sites
payment solutions 1'244 sites marketing service 812 sites
harland clarke 16 sites

Harlandclarke.com Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
outstandings checks wiki
1 2016-01-30
harlin clark aacreditunion.org
1 2016-01-25
harland
1 2016-01-22
acquisition engine
1 2016-01-12
harland clarke phone number
1 2016-01-04
harland clarke colorado springs
1 2015-12-21
harland clarke jobs
1 2015-12-21
trackable shipping
1 2015-12-09
harlandclarke
1 2015-12-09
harlan clarke
1 2015-12-08

Harlandclarke.com Anchors Cloud

Anchors Cloud: List of most used anchor phrases in the anchor tags of the referring domains. An example would be "webstatsdomain" in "<a href="https://webstatsdomain.org">webstatsdomain</a>"

  • <a>image</a>( 58% )
  • harland clarke( 7% )
  • check reordering( 7% )
  • reorder checks( 7% )
  • take a more comprehensive approach to loan marketing( 4% )
  • order checks( 4% )
  • check ordering( 4% )
  • click for details( 4% )

Harlandclarke.com Terms Cloud

List of most used terms in the anchor text of the referring domains. An example would be "Webstatsdomain" in "<a href="https://webstatsdomain.org">Free website statistics, analysis, review - Webstatsdomain</a>"

  • checks( 11% )
  • check( 11% )
  • <a>image</a>( 5% )
  • harland( 5% )
  • clarke( 5% )
  • reordering( 5% )
  • reorder( 5% )
  • take( 5% )
  • comprehensive( 5% )
  • approach( 5% )
  • loan( 5% )
  • marketing( 5% )
  • order( 5% )
  • ordering( 5% )
  • click( 5% )
  • details( 5% )

Harlandclarke.com Websites hosted on same IP

 

Hchc Organization | Harland Clarke Holdings

| | www.harlandclarkeholdings.com

Harlandclarke.com Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-30, website load time was 0.24. The highest load time is 0.47, the lowest load time is 0.24, the average load time is 0.31.

Whois Lookup For harlandclarke.com

0reviews

Add review